PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010543581.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family NAC
Protein Properties Length: 567aa    MW: 63052 Da    PI: 4.308
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010543581.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.16.8e-5391361128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                     l+pGfrFhPtdeelv +yLk+k+ +k++++ ++i+ +diyk+ePwdLp k k+k+++ ewyfFs  dkky +g+++nrat++gyWk+tgkd+e+ 
  XP_010543581.1   9 LAPGFRFHPTDEELVRYYLKRKICNKPFRF-DAISVIDIYKSEPWDLPdKsKLKSRDLEWYFFSVLDKKYGNGSKTNRATEKGYWKTTGKDREIR 102
                     579**************************9.99**************95347777888************************************* PP

             NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     + +++ vg+kktLv+++grap+ge+t+Wvmheyrl
  XP_010543581.1 103 N-GSRIVGMKKTLVYHRGRAPRGERTNWVMHEYRL 136
                     9.99*****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.83E-627159IPR003441NAC domain
PROSITE profilePS5100558.5949159IPR003441NAC domain
PfamPF023657.2E-2811136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 567 aa     Download sequence    Send to blast
MGRDSVTSLA PGFRFHPTDE ELVRYYLKRK ICNKPFRFDA ISVIDIYKSE PWDLPDKSKL  60
KSRDLEWYFF SVLDKKYGNG SKTNRATEKG YWKTTGKDRE IRNGSRIVGM KKTLVYHRGR  120
APRGERTNWV MHEYRLIDEE LGKTGVAQDA YVLCRIFQKS GSGPKNGEQY GAPFIEEEWE  180
DGGDEMMMML VPDQDALPEG LAFDNDDDFY VDIDELDQKP DNVEIYDAIP LASNFYPGES  240
SNNIESGNYS DTGNYIQPGN YVKDSPDEDQ KPIIRTDGIQ PVSMLPDELT GCDVQEENAE  300
NSLTSNDIFA AEGNYVSVPD DQFLLGQPFV DADHDLPSND GMYLETNDLG TTTHQDSLNF  360
EDYLTFFDID DEITAQLSFD ASQLVGTEDS VPRLEDLTEK AEREGLEKET TTCEHLVEGK  420
DKDEASCSKH DPDATPFESD SKYPFLKKAS HMLGGIPAPP AFASEFPTKD AAIRLHSAAQ  480
SSGSVHVTAG MIRISSMTVA EGSGMDWSYG KNGNLNVVFS LGLVQGADTG LSGKTGATLS  540
RAMLILVCFW VLILSVSFKV GTIVSAR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-46816516171NO APICAL MERISTEM PROTEIN
1ut4_B3e-46816516171NO APICAL MERISTEM PROTEIN
1ut7_A3e-46816516171NO APICAL MERISTEM PROTEIN
1ut7_B3e-46816516171NO APICAL MERISTEM PROTEIN
3swm_A4e-46816519174NAC domain-containing protein 19
3swm_B4e-46816519174NAC domain-containing protein 19
3swm_C4e-46816519174NAC domain-containing protein 19
3swm_D4e-46816519174NAC domain-containing protein 19
3swp_A4e-46816519174NAC domain-containing protein 19
3swp_B4e-46816519174NAC domain-containing protein 19
3swp_C4e-46816519174NAC domain-containing protein 19
3swp_D4e-46816519174NAC domain-containing protein 19
4dul_A3e-46816516171NAC domain-containing protein 19
4dul_B3e-46816516171NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010543581.10.0PREDICTED: NAC domain-containing protein 78-like
SwissprotQ84K000.0NAC78_ARATH; NAC domain-containing protein 78
TrEMBLV4LD690.0V4LD69_EUTSA; Uncharacterized protein
STRINGscaffold_600382.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31922762
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04410.10.0NAC domain containing protein 2